Genome@Home

Damnit! Cliptin has overtaken :cry:

OK, I'm switching on the P3 again (had it off due to lack of network cable and couldn't be bothered to move my keyboard/video/mouse to it since I only have one of each so as to run off network)
 
Don't take it bad NRG, it will happen again (soon by Tannin) ;-)

And don't discourage yourself if you lose a position to someone else, you might always come back latter on to claim what was once yours (subtle message to Bartender and Doug).
 
oh yes, it will happen again from just about everyone - once I switch off this machine for summer and go home with the p3-733... bleh!
 
NRG = mc² said:
Damnit! Cliptin has overtaken :cry:
Click to expand...

Don't feel bad NRG. I'm also outproducing The JoJo and Cougtek in the weekly total column but I suspect version 3.0 will be out before I can catch them (Statsman indicates into August for The JoJo). They have a significant lead.

I only really started with the new machines on Friday, I think. Let's see what the rest of the week brings. :wink:
 
Cliptin said:
NRG = mc² said:
Damnit! Cliptin has overtaken :cry:
Click to expand...

Don't feel bad NRG. I'm also outproducing The JoJo and Cougtek in the weekly total column but I suspect version 3.0 will be out before I can catch them (Statsman indicates into August for The JoJo). They have a significant lead.

I only really started with the new machines on Friday, I think. Let's see what the rest of the week brings. :wink:
Click to expand...

Would one of those new machines be my old 8KHA+??

CLOCKER
 
Talking about genome client 2.0:

"Genome@home 2.0 to merge with Folding@home 3.0

The Genome@home project is proud to announce that we will be combining forces with Folding@home, our sister project at the Pande Group. The Genome@home protein design algorithm (specifically the 2.0 version, which has been under development for several months now) will be included as a F@h3.0 scientific "core", which will allow F@h and G@h users to run both projects from the same client. The original Genome@home project (i.e. version 0.99, soon to be referred to as "G@h Classic") will continue as a separate project indefinitely. Current G@h users need not switch to the new F@h3.0 client, but are encouraged to do so, as very little further development will take place on G@h Classic. The vast majority of new work will take place within the new F@h3.0 architecture. User and team statistics from G@h Classic will not be integrated into F@h3.0 and vice-versa. The two will exist as separate distributed computing research projects.

More details will be provided in an extensive FAQ, coming soon."

http://gah.stanford.edu/new.html#latest
 
And you Pradeep, are you switching to Folding@home or do you wait until the F@h client 3.0 gets out to continue crunching for the Genome@home?
 
Clocker said:
Would one of those new machines be my old 8KHA+??

CLOCKER
Click to expand...

Indeed. It has gain new life as my game machine that resides in my bedroom. I moved the pIII850, X15 out. I couldn't take the noise while trying to sleep anymore.

The 8KHA+ now lives with a Duron 950@1081 and D740X FB.
Ahhhhhhhhh.
 
What the hell am I crunching now?


Code: 
[September 24 22:28:22] Working on Unit 02
+ Working ...
[22:28:23] Genome@Home2 Core Version 2.02 (Sept 5, 2002)
[22:28:23]
[22:28:23] Proj: work/wudata_02
[22:28:23] Finding work files
[22:28:23] sizeof(CORE_PACKET_HDR) = 512
[22:28:23] Checking frame files
[22:28:23] - Couldn't open work/wudata_02.chk
[22:28:23] Starting from initial work packet
[22:28:23]
[22:28:23] Updating shared core-client information
[22:28:23] - Writing "work/wudata_02.key": (overwrite)successful.
[22:28:23] Key file to update shared file: work/wudata_02.key
[22:28:23]  keyfile: 0 30 200 15 2 1 0
[22:28:23] Protein: def1/pdbdef1.xyz
[22:28:23] - Frames Completed: 0, Remaining: 6000
[22:28:23] - Dynamic steps required: 1200000
[22:28:23]
[22:28:23] Printed current.prm
[22:28:23] Writing local files:
[22:28:23] - Writing "work/wudata_02.key": (overwrite)successful.
[22:28:23] - Writing "work/wudata_02.xyz": (overwrite)successful.
[22:28:23] - Writing "work/wudata_02.prm": (overwrite)successful.
[22:28:24] [SPA] project name: work/wudata_02.
[22:28:24] [SPA]   1  0
[22:28:24] [SPA] Initializing protein design algorithm
[22:28:24] [SPA] seed =            0
[22:28:24] [SPA] Initialization complete
[22:28:24] [SPA] Writing current.pdb, chainlength =  30
[22:28:24] [SPA] Writing current.xyz
[22:28:24] [SPA] Filtering . . .
[22:28:24] [Filter]    30 positions to filter
[22:28:24] [Filter]    30 positions to filter
[22:28:24] [Filter]   1 filtered
[22:28:24] [Filter]   2 filtered
[22:28:24] [Filter]   3 filtered
[22:28:25] [Filter]   4 filtered
[22:28:30] [Filter]   5 filtered
[22:28:30] [Filter]   6 filtered
[22:28:31] [Filter]   7 filtered
[22:28:31] [Filter]   8 filtered
[22:28:32] [Filter]   9 filtered
[22:28:32] [Filter]  10 filtered
[22:28:32] [Filter]  11 filtered
[22:28:33] [Filter]  12 filtered
[22:28:33] [Filter]  13 filtered
[22:28:33] [Filter]  14 filtered
[22:28:33] [Filter]  15 filtered
[22:28:33] [Filter]  16 filtered
[22:28:33] [Filter]  17 filtered
[22:28:34] [Filter]  18 filtered
[22:28:36] [Filter]  19 filtered
[22:28:36] [Filter]  20 filtered
[22:28:37] [Filter]  21 filtered
[22:28:37] [Filter]  22 filtered
[22:28:39] [Filter]  23 filtered
[22:28:39] [Filter]  24 filtered
[22:28:40] [Filter]  25 filtered
[22:28:40] [Filter]  26 filtered
[22:28:40] [Filter]  27 filtered
[22:28:40] [Filter]  28 filtered
[22:28:40] [Filter]  29 filtered
[22:28:41] [SPA] Filter complete
[22:28:41] Iterations: 0 of 6000
[22:28:42] Finished
[22:29:24] [SPA] Energy_Lookup
[22:29:24] [SPA] rotamer wheel done
[22:29:25] [SPA] seed:          7364213
[22:29:25] [SPA] Designing protein sequence  1 of 30
[22:30:20] [SPA]  10.0 %
[22:31:03] [SPA]  20.0 %
[22:31:42] [SPA]  30.0 %
[22:32:20] [SPA]  40.0 %
[22:32:58] [SPA]  50.0 %
[22:33:37] [SPA]  60.0 %
[22:34:16] [SPA]  70.0 %
[22:34:53] [SPA]  80.0 %
[22:35:32] [SPA]  90.0 %
[22:36:11] [SPA] 100.0 %
[22:36:11] [SPA] Sequence  1 completed:
[22:36:11] RKNTLNTNQTQSGAGTQTYNAGEQLVVSGS
[22:36:11] Iterations: 200 of 6000
[22:36:12] Finished
[22:36:12] [SPA] seed:         14728426
[22:36:12] [SPA] Designing protein sequence  2 of 30
[22:37:10] [SPA]  10.0 %
[22:37:56] [SPA]  20.0 %
[22:38:38] [SPA]  30.0 %
[22:39:23] [SPA]  40.0 %
[22:40:07] [SPA]  50.0 %
[22:40:50] [SPA]  60.0 %
[22:41:31] [SPA]  70.0 %
[22:42:15] [SPA]  80.0 %
[22:42:53] [SPA]  90.0 %
[22:43:31] [SPA] 100.0 %
[22:43:31] [SPA] Sequence  2 completed:
[22:43:31] TKTTANTNQNASGAGEATITAGQNKEESGS
[22:43:31] Iterations: 400 of 6000
[22:43:32] Finished
[22:43:33] [SPA] seed:         22092639
[22:43:33] [SPA] Designing protein sequence  3 of 30
[22:44:32] [SPA]  10.0 %
[22:45:19] [SPA]  20.0 %
[22:46:01] [SPA]  30.0 %
[22:46:37] [SPA]  40.0 %
[22:47:17] [SPA]  50.0 %
[22:47:58] [SPA]  60.0 %
[22:48:35] [SPA]  70.0 %
[22:49:14] [SPA]  80.0 %
[22:49:53] [SPA]  90.0 %
[22:50:29] [SPA] 100.0 %
[22:50:29] [SPA] Sequence  3 completed:
[22:50:29] RKTQASTYYPESGSGTATVVPGQMKVVSGS
[22:50:29] Iterations: 600 of 6000
[22:50:30] Finished
[22:50:31] [SPA] seed:         29456852
[22:50:31] [SPA] Designing protein sequence  4 of 30
 
You must log in or register to reply here.
Back
Top