Genome@Home

[NRG = mc²]

Damnit! Cliptin has overtaken

OK, I'm switching on the P3 again (had it off due to lack of network cable and couldn't be bothered to move my keyboard/video/mouse to it since I only have one of each so as to run off network)

 

[CougTek]

Don't take it bad NRG, it will happen again (soon by Tannin) ;-)

And don't discourage yourself if you lose a position to someone else, you might always come back latter on to claim what was once yours (subtle message to Bartender and Doug).

 

[NRG = mc²]

oh yes, it will happen again from just about everyone - once I switch off this machine for summer and go home with the p3-733... bleh!

 

[Cliptin]

Damnit! Cliptin has overtaken

Don't feel bad NRG. I'm also outproducing The JoJo and Cougtek in the weekly total column but I suspect version 3.0 will be out before I can catch them (Statsman indicates into August for The JoJo). They have a significant lead.

I only really started with the new machines on Friday, I think. Let's see what the rest of the week brings. :wink:

 

[Clocker]

Damnit! Cliptin has overtaken

Don't feel bad NRG. I'm also outproducing The JoJo and Cougtek in the weekly total column but I suspect version 3.0 will be out before I can catch them (Statsman indicates into August for The JoJo). They have a significant lead.

I only really started with the new machines on Friday, I think. Let's see what the rest of the week brings. :wink:

Would one of those new machines be my old 8KHA+??

CLOCKER

 

[Pradeep]

Talking about genome client 2.0:

"Genome@home 2.0 to merge with Folding@home 3.0

The Genome@home project is proud to announce that we will be combining forces with Folding@home, our sister project at the Pande Group. The Genome@home protein design algorithm (specifically the 2.0 version, which has been under development for several months now) will be included as a F@h3.0 scientific "core", which will allow F@h and G@h users to run both projects from the same client. The original Genome@home project (i.e. version 0.99, soon to be referred to as "G@h Classic") will continue as a separate project indefinitely. Current G@h users need not switch to the new F@h3.0 client, but are encouraged to do so, as very little further development will take place on G@h Classic. The vast majority of new work will take place within the new F@h3.0 architecture. User and team statistics from G@h Classic will not be integrated into F@h3.0 and vice-versa. The two will exist as separate distributed computing research projects.

More details will be provided in an extensive FAQ, coming soon."

http://gah.stanford.edu/new.html#latest

 

[CougTek]

And you Pradeep, are you switching to Folding@home or do you wait until the F@h client 3.0 gets out to continue crunching for the Genome@home?

 

[Cliptin]

Pradeep, Now you have the excuse to switch to the SF team. You know you wanna.

 

[Cliptin]

Would one of those new machines be my old 8KHA+??

CLOCKER

Indeed. It has gain new life as my game machine that resides in my bedroom. I moved the pIII850, X15 out. I couldn't take the noise while trying to sleep anymore.

The 8KHA+ now lives with a Duron 950@1081 and D740X FB.
Ahhhhhhhhh.

 

[Pradeep]

I'll be crunching genome 0.99 until the 3.0 client comes out. Then i'll prob switch to SF

 

[Bartender]

Predeep, apparently you're not the only one still crunching Genome. :mrgrn:

 

[NRG = mc²]

mwahahaha, overtook Cliptin again... and I still haven't transmitted the results from the P3 machine.

 

[Prof.Wizard]

Will, Cliptin is working on F@h...
Now you can overcome even handruin if you will...

 

[NRG = mc²]

Bah, Genome for me :mrgrn:

 

[Prof.Wizard]

Anyone crunching here now and then? :idea:
Besides me...

 

[Handruin]

What the hell am I crunching now?

[September 24 22:28:22] Working on Unit 02
+ Working ...
[22:28:23] Genome@Home2 Core Version 2.02 (Sept 5, 2002)
[22:28:23]
[22:28:23] Proj: work/wudata_02
[22:28:23] Finding work files
[22:28:23] sizeof(CORE_PACKET_HDR) = 512
[22:28:23] Checking frame files
[22:28:23] - Couldn't open work/wudata_02.chk
[22:28:23] Starting from initial work packet
[22:28:23]
[22:28:23] Updating shared core-client information
[22:28:23] - Writing "work/wudata_02.key": (overwrite)successful.
[22:28:23] Key file to update shared file: work/wudata_02.key
[22:28:23]  keyfile: 0 30 200 15 2 1 0
[22:28:23] Protein: def1/pdbdef1.xyz
[22:28:23] - Frames Completed: 0, Remaining: 6000
[22:28:23] - Dynamic steps required: 1200000
[22:28:23]
[22:28:23] Printed current.prm
[22:28:23] Writing local files:
[22:28:23] - Writing "work/wudata_02.key": (overwrite)successful.
[22:28:23] - Writing "work/wudata_02.xyz": (overwrite)successful.
[22:28:23] - Writing "work/wudata_02.prm": (overwrite)successful.
[22:28:24] [SPA] project name: work/wudata_02.
[22:28:24] [SPA]   1  0
[22:28:24] [SPA] Initializing protein design algorithm
[22:28:24] [SPA] seed =            0
[22:28:24] [SPA] Initialization complete
[22:28:24] [SPA] Writing current.pdb, chainlength =  30
[22:28:24] [SPA] Writing current.xyz
[22:28:24] [SPA] Filtering . . .
[22:28:24] [Filter]    30 positions to filter
[22:28:24] [Filter]    30 positions to filter
[22:28:24] [Filter]   1 filtered
[22:28:24] [Filter]   2 filtered
[22:28:24] [Filter]   3 filtered
[22:28:25] [Filter]   4 filtered
[22:28:30] [Filter]   5 filtered
[22:28:30] [Filter]   6 filtered
[22:28:31] [Filter]   7 filtered
[22:28:31] [Filter]   8 filtered
[22:28:32] [Filter]   9 filtered
[22:28:32] [Filter]  10 filtered
[22:28:32] [Filter]  11 filtered
[22:28:33] [Filter]  12 filtered
[22:28:33] [Filter]  13 filtered
[22:28:33] [Filter]  14 filtered
[22:28:33] [Filter]  15 filtered
[22:28:33] [Filter]  16 filtered
[22:28:33] [Filter]  17 filtered
[22:28:34] [Filter]  18 filtered
[22:28:36] [Filter]  19 filtered
[22:28:36] [Filter]  20 filtered
[22:28:37] [Filter]  21 filtered
[22:28:37] [Filter]  22 filtered
[22:28:39] [Filter]  23 filtered
[22:28:39] [Filter]  24 filtered
[22:28:40] [Filter]  25 filtered
[22:28:40] [Filter]  26 filtered
[22:28:40] [Filter]  27 filtered
[22:28:40] [Filter]  28 filtered
[22:28:40] [Filter]  29 filtered
[22:28:41] [SPA] Filter complete
[22:28:41] Iterations: 0 of 6000
[22:28:42] Finished
[22:29:24] [SPA] Energy_Lookup
[22:29:24] [SPA] rotamer wheel done
[22:29:25] [SPA] seed:          7364213
[22:29:25] [SPA] Designing protein sequence  1 of 30
[22:30:20] [SPA]  10.0 %
[22:31:03] [SPA]  20.0 %
[22:31:42] [SPA]  30.0 %
[22:32:20] [SPA]  40.0 %
[22:32:58] [SPA]  50.0 %
[22:33:37] [SPA]  60.0 %
[22:34:16] [SPA]  70.0 %
[22:34:53] [SPA]  80.0 %
[22:35:32] [SPA]  90.0 %
[22:36:11] [SPA] 100.0 %
[22:36:11] [SPA] Sequence  1 completed:
[22:36:11] RKNTLNTNQTQSGAGTQTYNAGEQLVVSGS
[22:36:11] Iterations: 200 of 6000
[22:36:12] Finished
[22:36:12] [SPA] seed:         14728426
[22:36:12] [SPA] Designing protein sequence  2 of 30
[22:37:10] [SPA]  10.0 %
[22:37:56] [SPA]  20.0 %
[22:38:38] [SPA]  30.0 %
[22:39:23] [SPA]  40.0 %
[22:40:07] [SPA]  50.0 %
[22:40:50] [SPA]  60.0 %
[22:41:31] [SPA]  70.0 %
[22:42:15] [SPA]  80.0 %
[22:42:53] [SPA]  90.0 %
[22:43:31] [SPA] 100.0 %
[22:43:31] [SPA] Sequence  2 completed:
[22:43:31] TKTTANTNQNASGAGEATITAGQNKEESGS
[22:43:31] Iterations: 400 of 6000
[22:43:32] Finished
[22:43:33] [SPA] seed:         22092639
[22:43:33] [SPA] Designing protein sequence  3 of 30
[22:44:32] [SPA]  10.0 %
[22:45:19] [SPA]  20.0 %
[22:46:01] [SPA]  30.0 %
[22:46:37] [SPA]  40.0 %
[22:47:17] [SPA]  50.0 %
[22:47:58] [SPA]  60.0 %
[22:48:35] [SPA]  70.0 %
[22:49:14] [SPA]  80.0 %
[22:49:53] [SPA]  90.0 %
[22:50:29] [SPA] 100.0 %
[22:50:29] [SPA] Sequence  3 completed:
[22:50:29] RKTQASTYYPESGSGTATVVPGQMKVVSGS
[22:50:29] Iterations: 600 of 6000
[22:50:30] Finished
[22:50:31] [SPA] seed:         29456852
[22:50:31] [SPA] Designing protein sequence  4 of 30

 

[Jake the Dog]

yah i got one of them too... takes ages as well.