NRG = mc² said:Damnit! Cliptin has overtaken![]()
Cliptin said:NRG = mc² said:Damnit! Cliptin has overtaken![]()
Don't feel bad NRG. I'm also outproducing The JoJo and Cougtek in the weekly total column but I suspect version 3.0 will be out before I can catch them (Statsman indicates into August for The JoJo). They have a significant lead.
I only really started with the new machines on Friday, I think. Let's see what the rest of the week brings. :wink:
Clocker said:Would one of those new machines be my old 8KHA+??
CLOCKER
[September 24 22:28:22] Working on Unit 02
+ Working ...
[22:28:23] Genome@Home2 Core Version 2.02 (Sept 5, 2002)
[22:28:23]
[22:28:23] Proj: work/wudata_02
[22:28:23] Finding work files
[22:28:23] sizeof(CORE_PACKET_HDR) = 512
[22:28:23] Checking frame files
[22:28:23] - Couldn't open work/wudata_02.chk
[22:28:23] Starting from initial work packet
[22:28:23]
[22:28:23] Updating shared core-client information
[22:28:23] - Writing "work/wudata_02.key": (overwrite)successful.
[22:28:23] Key file to update shared file: work/wudata_02.key
[22:28:23] keyfile: 0 30 200 15 2 1 0
[22:28:23] Protein: def1/pdbdef1.xyz
[22:28:23] - Frames Completed: 0, Remaining: 6000
[22:28:23] - Dynamic steps required: 1200000
[22:28:23]
[22:28:23] Printed current.prm
[22:28:23] Writing local files:
[22:28:23] - Writing "work/wudata_02.key": (overwrite)successful.
[22:28:23] - Writing "work/wudata_02.xyz": (overwrite)successful.
[22:28:23] - Writing "work/wudata_02.prm": (overwrite)successful.
[22:28:24] [SPA] project name: work/wudata_02.
[22:28:24] [SPA] 1 0
[22:28:24] [SPA] Initializing protein design algorithm
[22:28:24] [SPA] seed = 0
[22:28:24] [SPA] Initialization complete
[22:28:24] [SPA] Writing current.pdb, chainlength = 30
[22:28:24] [SPA] Writing current.xyz
[22:28:24] [SPA] Filtering . . .
[22:28:24] [Filter] 30 positions to filter
[22:28:24] [Filter] 30 positions to filter
[22:28:24] [Filter] 1 filtered
[22:28:24] [Filter] 2 filtered
[22:28:24] [Filter] 3 filtered
[22:28:25] [Filter] 4 filtered
[22:28:30] [Filter] 5 filtered
[22:28:30] [Filter] 6 filtered
[22:28:31] [Filter] 7 filtered
[22:28:31] [Filter] 8 filtered
[22:28:32] [Filter] 9 filtered
[22:28:32] [Filter] 10 filtered
[22:28:32] [Filter] 11 filtered
[22:28:33] [Filter] 12 filtered
[22:28:33] [Filter] 13 filtered
[22:28:33] [Filter] 14 filtered
[22:28:33] [Filter] 15 filtered
[22:28:33] [Filter] 16 filtered
[22:28:33] [Filter] 17 filtered
[22:28:34] [Filter] 18 filtered
[22:28:36] [Filter] 19 filtered
[22:28:36] [Filter] 20 filtered
[22:28:37] [Filter] 21 filtered
[22:28:37] [Filter] 22 filtered
[22:28:39] [Filter] 23 filtered
[22:28:39] [Filter] 24 filtered
[22:28:40] [Filter] 25 filtered
[22:28:40] [Filter] 26 filtered
[22:28:40] [Filter] 27 filtered
[22:28:40] [Filter] 28 filtered
[22:28:40] [Filter] 29 filtered
[22:28:41] [SPA] Filter complete
[22:28:41] Iterations: 0 of 6000
[22:28:42] Finished
[22:29:24] [SPA] Energy_Lookup
[22:29:24] [SPA] rotamer wheel done
[22:29:25] [SPA] seed: 7364213
[22:29:25] [SPA] Designing protein sequence 1 of 30
[22:30:20] [SPA] 10.0 %
[22:31:03] [SPA] 20.0 %
[22:31:42] [SPA] 30.0 %
[22:32:20] [SPA] 40.0 %
[22:32:58] [SPA] 50.0 %
[22:33:37] [SPA] 60.0 %
[22:34:16] [SPA] 70.0 %
[22:34:53] [SPA] 80.0 %
[22:35:32] [SPA] 90.0 %
[22:36:11] [SPA] 100.0 %
[22:36:11] [SPA] Sequence 1 completed:
[22:36:11] RKNTLNTNQTQSGAGTQTYNAGEQLVVSGS
[22:36:11] Iterations: 200 of 6000
[22:36:12] Finished
[22:36:12] [SPA] seed: 14728426
[22:36:12] [SPA] Designing protein sequence 2 of 30
[22:37:10] [SPA] 10.0 %
[22:37:56] [SPA] 20.0 %
[22:38:38] [SPA] 30.0 %
[22:39:23] [SPA] 40.0 %
[22:40:07] [SPA] 50.0 %
[22:40:50] [SPA] 60.0 %
[22:41:31] [SPA] 70.0 %
[22:42:15] [SPA] 80.0 %
[22:42:53] [SPA] 90.0 %
[22:43:31] [SPA] 100.0 %
[22:43:31] [SPA] Sequence 2 completed:
[22:43:31] TKTTANTNQNASGAGEATITAGQNKEESGS
[22:43:31] Iterations: 400 of 6000
[22:43:32] Finished
[22:43:33] [SPA] seed: 22092639
[22:43:33] [SPA] Designing protein sequence 3 of 30
[22:44:32] [SPA] 10.0 %
[22:45:19] [SPA] 20.0 %
[22:46:01] [SPA] 30.0 %
[22:46:37] [SPA] 40.0 %
[22:47:17] [SPA] 50.0 %
[22:47:58] [SPA] 60.0 %
[22:48:35] [SPA] 70.0 %
[22:49:14] [SPA] 80.0 %
[22:49:53] [SPA] 90.0 %
[22:50:29] [SPA] 100.0 %
[22:50:29] [SPA] Sequence 3 completed:
[22:50:29] RKTQASTYYPESGSGTATVVPGQMKVVSGS
[22:50:29] Iterations: 600 of 6000
[22:50:30] Finished
[22:50:31] [SPA] seed: 29456852
[22:50:31] [SPA] Designing protein sequence 4 of 30